PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G10220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 314aa    MW: 34180.1 Da    PI: 5.5677
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G10220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox246.7e-082562892154
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      k +yp++e++++L +++gL+ +q+ +WF N+R +
  OGLUM08G10220.1 256 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 289
                      569*****************************87 PP

2ELK26.81.2e-09210231122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELKh+L+++Y+++L+++++E++
  OGLUM08G10220.1 210 ELKHELKQGYKEKLIDIREEIL 231
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.6E-174690IPR005540KNOX1
PfamPF037901.4E-165089IPR005540KNOX1
SMARTSM012565.5E-2799155IPR005541KNOX2
PfamPF037911.1E-18107154IPR005541KNOX2
PROSITE profilePS5121310.039210230IPR005539ELK domain
SMARTSM011880.004210231IPR005539ELK domain
PROSITE profilePS5007111.742230293IPR001356Homeobox domain
SuperFamilySSF466893.17E-16232297IPR009057Homeodomain-like
SMARTSM003894.8E-11232297IPR001356Homeobox domain
CDDcd000863.72E-12233294No hitNo description
Gene3DG3DSA:1.10.10.604.4E-25237294IPR009057Homeodomain-like
PfamPF059208.4E-18250289IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAFHDHLPHE MTMQALGADD AATTSDSSAS PSGAAAAAAA AAAAAAAAGA EILAHPLYEQ  60
LLSAHVACLR IATPVDQLPR IDAQLAQSQG VVAKYSALAA AAAGDDGREL DQFMTHYVLL  120
LCSFKEQLQQ HVRVHAMEAV MACWELEQNL QSLTGASPGE GTGATMSDGE DDQADSEANM  180
YDPSLDGADN MGFGLPTESE RSLMERVRQE LKHELKQGYK EKLIDIREEI LRKRRAGKLP  240
GDTTSTLKAW WQSHAKWPYP TEEDKARLVQ ETGLQLKQIN NWFINQRKRN WHSNPSSSTS  300
VKTKRKSNAG DNNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A6e-13233297872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8345860.0CT834586.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN056I08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650700.10.0PREDICTED: homeobox protein knotted-1-like 13 isoform X1
SwissprotQ0J6N40.0KNOSD_ORYSJ; Homeobox protein knotted-1-like 13
TrEMBLA0A0E0ATH40.0A0A0E0ATH4_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g19650.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-156KNOTTED1-like homeobox gene 3